Sentences with phrase «develop antibodies against it»

«Ideally, horses will develop antibodies against the relevant vaccine strain, resulting in a significant reduction of clinical disease and nasal shedding of the virus,» points out Hancock.

When monkeys and apes are infected with Zika, they develop antibodies against the virus in approximately 14 days.

To protect our dogs from disease, vaccines are administered to trigger the immune system to develop antibodies against that disease.

During the next two weeks, the pet either develop antibodies against the disease that protect it and kills the virus or it gradually goes downhill.

However, most cats treated with EPO eventually develop antibodies against it, resulting in treatment discontinuation.

Previous studies had shown that the apicoplast - targeting drugs have a delayed - death effect: They allow the parasite to grow and replicate in the liver, where the immune system can develop antibodies against the invaders.

The researchers purified 312 of the proteins, injected them individually into female mice, waited for the mice to develop antibodies against the proteins, and then tested the offspring of the injected mice for their susceptibility to the bugs.

The flu vaccine works by exposing the body to parts of inactivated flu from the three major different types of flu that infect humans, prompting the immune system to develop antibodies against these viruses.

As a further therapeutic option, the researchers are pursuing the approach of using specifically developed antibodies against CEACAMs in order to fight diseases associated with the bacterium.

While investigating adult - onset diabetes, they found evidence that diabetics being treated with animal insulin developed antibodies against the foreign protein, which was believed to be too small to elicit such an immune response.

They also reported that no patients developed antibodies against the factor, also known as «inhibitors.»

Specifically, the immune system develops antibodies against these unwanted substances and then mounts an attack against them.

As an example, most people think the Cavalier King Charles Spaniel's predisposition to heart disease is just genetic... but Dr Larry Glickman at Purdue University found that Cavalier King Charles Spaniels developed antibodies against their own heart tissue after vaccination.

A positive test result only means the cat has had a prior exposure to a coronavirus — not necessarily one that causes FIP — and has developed antibodies against that virus.

When a vaccine is injected, the body develops antibodies against the particles in the vaccine.

Another more recent study found indications that some cats with EGC might have actually become allergic (developed antibodies against) to their own saliva!

Not exact matches

If she had a herpes virus, and antibodies have developed in her body, it is possible that her baby already had a protection against it.

Your breast milk is packed with antibodies to protect your little one against infection, as well as reduce the likelihood of them developing allergies such as asthma and eczema.

It takes about two weeks after vaccination for antibodies to develop and to provide protection against the flu.

Based on their findings, they urge that «mosquito saliva and enhancing antibodies thus need to be considered when developing vaccines and drugs against dengue,» and specifically suggest that «animal models of dengue and pre-clinical validation of dengue vaccine candidates should be evaluated in the combined presence of mosquito saliva and enhancing antibodies.»

The x-ray crystallographer at the Scripps Research Institute in San Diego, California, is leading an international effort to develop a potent mix of monoclonal antibodies against the virus, some of which have already shown promise in animals.

At the time, Janeway was arguing that antibodies have a big drawback: it takes days for the immune system to develop an effective antibody against a new invader.

Scientists at Dana - Farber Cancer Institute have identified natural human antibodies against the virus that causes Middle East Respiratory Syndrome (MERS), a step toward developing treatments for the newly emerging and often - fatal disease..

When treated with replacement coagulation proteins, the dog naturally develops antibodies, or inhibitors, against the therapy — a problem that is also seen in some 5 % of humans with haemophilia B.

All three of the exposed animals not only survived the virus but developed high amounts of protective antibodies against it, likely protecting them against future exposures (although the research team has not yet explored how long that immunity lasts).

«Our results provide a roadmap to developing a single antibody - based treatment effective against not only infections caused by Ebola Zaire virus, but also caused by related filoviruses.»

One problem revealed by the trial was that only 38 percent of vaccinated subjects developed high levels of antibodies against the drug; Kosten is working to increase the vaccine's antibody generation.

He says that researchers could one day spare scores of lives and nip potential epidemics in the bud by whipping up a treatment within a month from natural antibodies that survivors developed against the threatening disease.

Future studies will include closer biological investigation to understand exactly how built - up immunoglobulin antibodies protect against Zika infection in mothers and their developing fetal offspring.

«The rejection rates were low and the chances of the patient developing a new antibody against their kidney were very low.

There are antibodies that have been developed now that basically block those inhibitory signals and allow the immune system to act against the cancers.»

Efforts to develop a universal flu vaccine may have stalled, but the research has revealed an antibody that protects against several lethal flu strains

As the team reports today in Science Translational Medicine, no one developed malaria or suffered serious harm in this first phase of human tests, and the vaccine triggered antibodies against the sporozoites.

Scientists investigating the potentially deadly hantavirus have used a novel approach to developing protective antibodies against it.

The TEDDY study's international research team has identified the new gene regions in young people who have already developed type 1 diabetes or who have started making antibodies against their...

Those antibodies could be used to develop vaccines to protect against Zika, as well as therapies to treat the virus, according to the study, which was a collaboration between researchers at UNC's Gillings School of Global Public Health and the UNC School of Medicine.

This antibody was developed against Recombinant Protein corresponding to amino acids: RSLYGGPELVFPEAMNHPALTVHPAHQLGASPLQPPHSFFGAQHRDPLHFYPWVLRNRFFGHRFQASDVPQDGLLLHGPFARKPKRI

Ahmedâ $ ™ s team had showed that people infected by the 2009 H1N1 flu strain developed broadly protective antibodies, and separately, so did volunteers immunized against the H5N1 avian flu virus.

NIAID is working to further develop this strategy and to evaluate and improve broadly neutralizing antibodies against HIV.

The Weiner lab has received funding from the Bill and Melinda Gates foundation for a collaborative project with Inovio Pharmaceuticals and HUMABS BioMed to develop DNA encoded monoclonal antibodies (DMAbs) against Zika.

Inserm Unit U919, directed by Prof. Denis Vivien («Serine Proteases and Physiopathology of the Neurovascular Unit») has developed an antibody with potential therapeutic effects against multiple sclerosis.

This platform has enabled the Company and its collaboration partners to discover and develop high - quality therapeutic antibodies against a variety of molecular targets, including targets that are difficult to drug with conventional antibody technologies.

Researchers are making progress in developing vaccine immunogens designed to induce broadly neutralizing antibodies (bNAbs) against HIV.

What this means for me, two years later, is not entirely clear: Some research suggests that once you have dengue, you develop antibodies that protect you against getting the same strain again.

Celiac disease develops when a person makes antibodies against a wheat protein called gluten such that eating anything containing gluten results in intestinal discomfort and a variety other symptoms including joint pain, skin rashes, and fatigue.

Under these difficult conditions, your immune system is less likely to properly complete all of its checks and balances, «tolerance» never develops, and the auto - antibodies can end up misleading your white blood cells into launching an attack against your own tissues.

About 99.6 % of people are genetically capable of developing antibodies to wheat gluten; about 11 % of the population develops systemic IgG antibodies against gluten.

Why the illness appears earlier in some is a mystery, but there is evidence that some children (1 in 1,000) may develop the disorder after a strep infection, when an antibody generated to fight the bacteria mistakenly turns against a brain enzyme and disrupts communication between neurons.

If your dog is infected when he receives vaccine or if he has an antibody that works against the vaccine, he may still develop kennel cough.

In humans, a test now exists that measures the amount of antibodies (or autoimmunity) a person has developed against his own adrenal glands (21OHAb antibodies).